Recombinant Human F12 protein, His-tagged
| Cat.No. : | F12-764H |
| Product Overview : | Recombinant Human F12 protein(P00748)(20-372aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 20-372aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.3 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | IPPWEAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGAFCDVDTKASCYDGRGLSYRGLARTTLSGAPCQPWASEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLNRDRLSWEYCDLAQCQTPTQAAPPTPVSPRLHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCGQRLRKSLSSMTR |
| Gene Name | F12 coagulation factor XII (Hageman factor) [ Homo sapiens ] |
| Official Symbol | F12 |
| Synonyms | F12; coagulation factor XII (Hageman factor); coagulation factor XII; Hageman factor; beta-factor XIIa part 1; beta-factor XIIa part 2; coagulation factor XIIa heavy chain; coagulation factor XIIa light chain; HAF; HAE3; HAEX; |
| Gene ID | 2161 |
| mRNA Refseq | NM_000505 |
| Protein Refseq | NP_000496 |
| MIM | 610619 |
| UniProt ID | P00748 |
| ◆ Recombinant Proteins | ||
| F12-773H | Recombinant Human F12 protein, His & T7-tagged | +Inquiry |
| F12-909M | Recombinant Mouse F12 Protein, His-tagged | +Inquiry |
| F12-3287R | Recombinant Rat F12 protein, His-tagged | +Inquiry |
| F12-3290R | Recombinant Rat F12 protein, His-SUMO-tagged | +Inquiry |
| F12-3286R | Recombinant Rat F12 protein, His-SUMO-tagged | +Inquiry |
| ◆ Native Proteins | ||
| F12-28805TH | Native Human F12 | +Inquiry |
| F12-5397H | Active Native Human Coagulation Factor XII (Hageman factor) | +Inquiry |
| F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| F12-2115HCL | Recombinant Human F12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F12 Products
Required fields are marked with *
My Review for All F12 Products
Required fields are marked with *
