Recombinant Human FGF23 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FGF23-3431H |
Product Overview : | FGF23 MS Standard C13 and N15-labeled recombinant protein (NP_065689) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC). |
Molecular Mass : | 28 kDa |
AA Sequence : | MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FGF23 fibroblast growth factor 23 [ Homo sapiens (human) ] |
Official Symbol | FGF23 |
Synonyms | FGF23; fibroblast growth factor 23; ADHR; FGFN; HYPF; HFTC2; HPDR2; PHPTC; fibroblast growth factor 23; phosphatonin; tumor-derived hypophosphatemia inducing factor |
Gene ID | 8074 |
mRNA Refseq | NM_020638 |
Protein Refseq | NP_065689 |
MIM | 605380 |
UniProt ID | Q9GZV9 |
◆ Recombinant Proteins | ||
Fgf23-27M | Active Recombinant Mouse Fgf23 | +Inquiry |
FGF23-684H | Recombinant Human FGF23 Protein, His-tagged | +Inquiry |
FGF23-523H | Recombinant Human FGF23 protein | +Inquiry |
Fgf23-417M | Recombinant Mouse Fibroblast Growth Factor 23, Fc Chimera | +Inquiry |
FGF23-1699R | Recombinant Rhesus monkey FGF23 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF23-6241HCL | Recombinant Human FGF23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF23 Products
Required fields are marked with *
My Review for All FGF23 Products
Required fields are marked with *