Recombinant Human FGF23 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FGF23-3431H
Product Overview : FGF23 MS Standard C13 and N15-labeled recombinant protein (NP_065689) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC).
Molecular Mass : 28 kDa
AA Sequence : MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FGF23 fibroblast growth factor 23 [ Homo sapiens (human) ]
Official Symbol FGF23
Synonyms FGF23; fibroblast growth factor 23; ADHR; FGFN; HYPF; HFTC2; HPDR2; PHPTC; fibroblast growth factor 23; phosphatonin; tumor-derived hypophosphatemia inducing factor
Gene ID 8074
mRNA Refseq NM_020638
Protein Refseq NP_065689
MIM 605380
UniProt ID Q9GZV9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF23 Products

Required fields are marked with *

My Review for All FGF23 Products

Required fields are marked with *

0
cart-icon
0
compare icon