Recombinant Human MBLAC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MBLAC2-1548H
Product Overview : MBLAC2 MS Standard C13 and N15-labeled recombinant protein (NP_981951) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : MBLAC2 (Metallo-Beta-Lactamase Domain Containing 2) is a Protein Coding gene. Diseases associated with MBLAC2 include Jalili Syndrome and Tetralogy Of Fallot. Gene Ontology (GO) annotations related to this gene include hydrolase activity. An important paralog of this gene is PNKD.
Molecular Mass : 31.3 kDa
AA Sequence : MSALEWYAHKSLGDGIFWIQERFYESGNRANIWLVRGSEQDVVIDTGLGLRSLPEYLYSSGLLQDREAKEDAARRPLLAVATHVHFDHSGGLYQFDRVAVHHAEAEALARGDNFETVTWLSDSEVVRAPSPGWRARQFRVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGDVVYDGSLIDWLPYSRISDYVGTCERLIELVDRGLVEKVLPGHFNTFGAERLFRLASNYISKAGICHKVSTFAMRSLASLALRVTNSRTSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MBLAC2 metallo-beta-lactamase domain containing 2 [ Homo sapiens (human) ]
Official Symbol MBLAC2
Synonyms MBLAC2; metallo-beta-lactamase domain containing 2; MBLAC2; metallo-beta-lactamase domain containing 2; metallo-beta-lactamase domain-containing protein 2
Gene ID 153364
mRNA Refseq NM_203406
Protein Refseq NP_981951
UniProt ID Q68D91

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MBLAC2 Products

Required fields are marked with *

My Review for All MBLAC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon