Recombinant Human PRTN3 protein, GST-tagged
Cat.No. : | PRTN3-301563H |
Product Overview : | Recombinant Human PRTN3 (189-150 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asn89-Thr150 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | NVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PRTN3 proteinase 3 [ Homo sapiens ] |
Official Symbol | PRTN3 |
Synonyms | PRTN3; proteinase 3; myeloblastin; ACPA; AGP7; C ANCA; MBT; P29; PR 3; serine proteinase; neutrophil; Wegener granulomatosis autoantigen; NP-4; C-ANCA antigen; wegener autoantigen; leukocyte proteinase 3; neutrophil proteinase 4; azurophil granule protein 7; serine proteinase, neutrophil; MBN; NP4; PR3; PR-3; CANCA; C-ANCA; |
Gene ID | 5657 |
mRNA Refseq | NM_002777 |
Protein Refseq | NP_002768 |
MIM | 177020 |
UniProt ID | P24158 |
◆ Recombinant Proteins | ||
PRTN3-45H | Recombinant Human PRTN3 protein, His-tagged | +Inquiry |
Prtn3-6958M | Recombinant Mouse Prtn3 protein, His-tagged | +Inquiry |
PRTN3-6020H | Recombinant Human PRTN3 Protein (Ile28-Arg249), N-GST tagged | +Inquiry |
PRTN3-001H | Recombinant Human PRTN3 Protein, His tagged | +Inquiry |
PRTN3-2633H | Recombinant Human PRTN3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRTN3-2797HCL | Recombinant Human PRTN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRTN3 Products
Required fields are marked with *
My Review for All PRTN3 Products
Required fields are marked with *