Recombinant Human PRTN3 protein, GST-tagged
| Cat.No. : | PRTN3-301563H |
| Product Overview : | Recombinant Human PRTN3 (189-150 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Asn89-Thr150 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | NVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | PRTN3 proteinase 3 [ Homo sapiens ] |
| Official Symbol | PRTN3 |
| Synonyms | PRTN3; proteinase 3; myeloblastin; ACPA; AGP7; C ANCA; MBT; P29; PR 3; serine proteinase; neutrophil; Wegener granulomatosis autoantigen; NP-4; C-ANCA antigen; wegener autoantigen; leukocyte proteinase 3; neutrophil proteinase 4; azurophil granule protein 7; serine proteinase, neutrophil; MBN; NP4; PR3; PR-3; CANCA; C-ANCA; |
| Gene ID | 5657 |
| mRNA Refseq | NM_002777 |
| Protein Refseq | NP_002768 |
| MIM | 177020 |
| UniProt ID | P24158 |
| ◆ Recombinant Proteins | ||
| Prtn3-6958M | Recombinant Mouse Prtn3 protein, His-tagged | +Inquiry |
| PRTN3-7193M | Recombinant Mouse PRTN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRTN3-45H | Recombinant Human PRTN3 protein, His-tagged | +Inquiry |
| PRTN3-31105TH | Recombinant Human PRTN3 | +Inquiry |
| PRTN3-1556HFL | Recombinant Full Length Human PRTN3 Protein, C-Flag-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
| PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
| PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRTN3-2797HCL | Recombinant Human PRTN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRTN3 Products
Required fields are marked with *
My Review for All PRTN3 Products
Required fields are marked with *
