Recombinant Human SNRPD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SNRPD2-4877H
Product Overview : SNRPD2 MS Standard C13 and N15-labeled recombinant protein (NP_004588) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 13.5 kDa
AA Sequence : MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SNRPD2 small nuclear ribonucleoprotein D2 polypeptide 16.5kDa [ Homo sapiens (human) ]
Official Symbol SNRPD2
Synonyms SNRPD2; small nuclear ribonucleoprotein D2 polypeptide 16.5kDa; small nuclear ribonucleoprotein D2 polypeptide (16.5kD), SNRPD1; small nuclear ribonucleoprotein Sm D2; Sm D2; snRNP core protein D2; SMD2; Sm-D2; SNRPD1;
Gene ID 6633
mRNA Refseq NM_004597
Protein Refseq NP_004588
MIM 601061
UniProt ID P62316

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNRPD2 Products

Required fields are marked with *

My Review for All SNRPD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon