Recombinant Human THPO Protein, GMP Grade, Animal-Free
Cat.No. : | THPO-41HG |
Product Overview : | GMP Recombinant Human THPO protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | TPO is a lineage-specific growth factor produced in the liver, kidney and skeletal muscle. It stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the c-mpl receptor, and acts as an important regulator of circulating platelets. |
AA Sequence : | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL |
Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
Gene Name | THPO thrombopoietin [ Homo sapiens (human) ] |
Official Symbol | THPO |
Synonyms | THPO; thrombopoietin; ML; TPO; MGDF; MKCSF; MPLLG; THCYT1; thrombopoietin; MPL ligand; c-mpl ligand; megakaryocyte colony-stimulating factor; megakaryocyte growth and development factor; megakaryocyte stimulating factor; myeloproliferative leukemia virus oncogene ligand; prepro-thrombopoietin; thrombopoietin nirs |
Gene ID | 7066 |
mRNA Refseq | NM_000460 |
Protein Refseq | NP_000451 |
MIM | 600044 |
UniProt ID | P40225 |
◆ Recombinant Proteins | ||
Thpo-6819M | Recombinant Mouse Thpo Protein (Ser22Thr356), N-His tagged | +Inquiry |
THPO-1163C | Active Recombinant Cynomolgus THPO protein, His-tagged | +Inquiry |
THPO-176H | Recombinant Human Thrombopoietin | +Inquiry |
Thpo-1782M | Recombinant Mouse Thrombopoietin, Fc Chimera | +Inquiry |
THPO-289H | Recombinant Human THPO Protein (Ser22-Leu195), N-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
THPO-001HCL | Recombinant Human THPO cell lysate | +Inquiry |
THPO-2832HCL | Recombinant Human THPO cell lysate | +Inquiry |
THPO-2831MCL | Recombinant Mouse THPO cell lysate | +Inquiry |
THPO-2273CCL | Recombinant Cynomolgus THPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All THPO Products
Required fields are marked with *
My Review for All THPO Products
Required fields are marked with *