Recombinant Human THPO Protein, GMP Grade, Animal-Free

Cat.No. : THPO-41HG
Product Overview : GMP Recombinant Human THPO protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : TPO is a lineage-specific growth factor produced in the liver, kidney and skeletal muscle. It stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the c-mpl receptor, and acts as an important regulator of circulating platelets.
AA Sequence : SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL
Purity : ≥ 98% by SDS-PAGE gel and HPLC analyses.
Gene Name THPO thrombopoietin [ Homo sapiens (human) ]
Official Symbol THPO
Synonyms THPO; thrombopoietin; ML; TPO; MGDF; MKCSF; MPLLG; THCYT1; thrombopoietin; MPL ligand; c-mpl ligand; megakaryocyte colony-stimulating factor; megakaryocyte growth and development factor; megakaryocyte stimulating factor; myeloproliferative leukemia virus oncogene ligand; prepro-thrombopoietin; thrombopoietin nirs
Gene ID 7066
mRNA Refseq NM_000460
Protein Refseq NP_000451
MIM 600044
UniProt ID P40225

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All THPO Products

Required fields are marked with *

My Review for All THPO Products

Required fields are marked with *

0
cart-icon
0
compare icon