Recombinant Human THPO Protein, GMP Grade, Animal-Free
| Cat.No. : | THPO-41HG |
| Product Overview : | GMP Recombinant Human THPO protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | TPO is a lineage-specific growth factor produced in the liver, kidney and skeletal muscle. It stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the c-mpl receptor, and acts as an important regulator of circulating platelets. |
| AA Sequence : | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL |
| Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
| Gene Name | THPO thrombopoietin [ Homo sapiens (human) ] |
| Official Symbol | THPO |
| Synonyms | THPO; thrombopoietin; ML; TPO; MGDF; MKCSF; MPLLG; THCYT1; thrombopoietin; MPL ligand; c-mpl ligand; megakaryocyte colony-stimulating factor; megakaryocyte growth and development factor; megakaryocyte stimulating factor; myeloproliferative leukemia virus oncogene ligand; prepro-thrombopoietin; thrombopoietin nirs |
| Gene ID | 7066 |
| mRNA Refseq | NM_000460 |
| Protein Refseq | NP_000451 |
| MIM | 600044 |
| UniProt ID | P40225 |
| ◆ Recombinant Proteins | ||
| THPO-2754H | Recombinant Human THPO protein(22-353 aa), N-MBP & C-His-tagged | +Inquiry |
| THPO-98H | Recombinant Human Thrombopoietin, His-tagged | +Inquiry |
| THPO-27H | Active Recombinant Human Thrombopoietin | +Inquiry |
| THPO-29520TH | Recombinant Human THPO | +Inquiry |
| THPO-305H | Recombinant Active Human THPO Protein, His-tagged(N-ter) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| THPO-001HCL | Recombinant Human THPO cell lysate | +Inquiry |
| THPO-2831MCL | Recombinant Mouse THPO cell lysate | +Inquiry |
| THPO-2832HCL | Recombinant Human THPO cell lysate | +Inquiry |
| THPO-2273CCL | Recombinant Cynomolgus THPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All THPO Products
Required fields are marked with *
My Review for All THPO Products
Required fields are marked with *



