Recombinant Mouse Il12a Protein Il12a-086M

Recombinant Mouse Il12a Protein

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Il12a Protein

Recombinant Mouse Il12a Protein

Online Inquiry

Il12a Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Il12a-086M Optional Service: Optional requirements on this protein
Product Overview : Purified recombinant protein of Mouse interleukin 12a (Il12a), transcript variant 2 without tag was expressed in CHO cell.
Description : Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.
Source : CHO
Species : Mouse
Bio-activity : Assay #1: ED50 was determined by the stimulation of IFN-gamma production by murine splenocytes co-stimulated with IL-18 is > 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg. Assay #2: Determined by its ability to stimulate the proliferation of 2D6 cells. The expected ED50 is <0.1ng/ml, corresponding to a specific activity of >1 x 10^7 units/mg.
Molecular Mass : 75 kDa
AA Sequence : p35 Subunit: RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
p40 Subunit: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name : Il12a interleukin 12a [ Mus musculus (house mouse) ]
Official Symbol : Il12a
Synonyms : Il12a; interleukin 12a; p35; Ll12a; Il-12a; IL-12p35; interleukin-12 subunit alpha; CLMF p35; IL-12 p35 subunit; IL-12 subunit p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; interleukin 12a p35 subunit; interleukin-12 p35 subunit
Gene ID : 16159
mRNA Refseq : NM_008351
Protein Refseq : NP_032377
UniProt ID : P43431
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry


  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2023 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy