Recombinant Mouse IL25 Protein

Cat.No. : IL25-166M
Product Overview : Recombinant Mouse IL25 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Interleukin 17E (IL-17E), also known as IL-25, is a member of the IL-17 family of cytokines. IL-17E binds to the IL-17RB receptor to stimulate the secretion of the proinflammatory interleukin 8 (IL-8) chemokine and to induce the activation of nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB).
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Dimer, 17.6/35.2 kDa (154/308 aa)
AA Sequence : MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥90%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile 10 mM HCl at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Il25 interleukin 25 [ Mus musculus (house mouse) ]
Official Symbol IL25
Synonyms IL25; interleukin 25; interleukin-25; interleukin 17E; Il17e; IL-17e;
Gene ID 140806
mRNA Refseq NM_080729
Protein Refseq NP_542767
UniProt ID Q8VHC9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL25 Products

Required fields are marked with *

My Review for All IL25 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon