Recombinant Pig F12 Protein (20-371 aa), His-tagged
Cat.No. : | F12-2005P |
Product Overview : | Recombinant Pig F12 Protein (20-371 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His |
ProteinLength : | 20-371 aa |
Description : | Factor XII is a serum glycoprotein that participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. Prekallikrein is cleaved by factor XII to form kallikrein, which then cleaves factor XII first to alpha-factor XIIa and then trypsin cleaves it to beta-factor XIIa. Alpha-factor XIIa activates factor XI to factor XIa (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 43.8 kDa |
AA Sequence : | IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | F12 coagulation factor XII (Hageman factor) [ Sus scrofa ] |
Official Symbol | F12 |
Synonyms | F12; coagulation factor XII; HAF; factor XII; hageman factor; FXII; |
Gene ID | 397474 |
mRNA Refseq | NM_214242 |
Protein Refseq | NP_999407 |
UniProt ID | O97507 |
◆ Recombinant Proteins | ||
COL4A3BPA-8347Z | Recombinant Zebrafish COL4A3BPA | +Inquiry |
STAT4-3231H | Recombinant Human STAT4 protein, His-tagged | +Inquiry |
CCL24-0885H | Recombinant Human CCL24 Protein (Val27-Cys119), His tagged | +Inquiry |
SH-RS12500-5363S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS12500 protein, His-tagged | +Inquiry |
HAND1-7171H | Recombinant Human Heart And Neural Crest Derivatives Expressed 1, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG2-229H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
IgG-169H | Native Human IgG Fc fragment | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
NTF3-29249TH | Native Human NTF3 | +Inquiry |
Neuraminidase-008C | Active Native Clostridium perfringens Neuraminidase, Type V | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABTB2-9120HCL | Recombinant Human ABTB2 293 Cell Lysate | +Inquiry |
SOCS5-1579HCL | Recombinant Human SOCS5 293 Cell Lysate | +Inquiry |
LOC441488-4682HCL | Recombinant Human LOC441488 293 Cell Lysate | +Inquiry |
FNDC4-6173HCL | Recombinant Human FNDC4 293 Cell Lysate | +Inquiry |
STEAP1-1710HCL | Recombinant Human STEAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F12 Products
Required fields are marked with *
My Review for All F12 Products
Required fields are marked with *
0
Inquiry Basket