Active Recombinant Full Length Human LCP1 Protein, C-Flag-tagged
Cat.No. : | LCP1-205HFL |
Product Overview : | Recombinant Full Length Human LCP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme subtrate |
Molecular Mass : | 70.1 kDa |
AA Sequence : | MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRIS FDEFIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDC RHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTPFTIQENLNLALNSASAIGCHVVN IGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLEN AGCNKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFV TATDVVRGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDL SDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTL TLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAEKSSSISSFKDPKISTSLPVLDLIDAIQ PGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | LCP1 lymphocyte cytosolic protein 1 [ Homo sapiens (human) ] |
Official Symbol | LCP1 |
Synonyms | LPL; CP64; PLS2; LC64P; HEL-S-37; L-PLASTIN |
Gene ID | 3936 |
mRNA Refseq | NM_002298.5 |
Protein Refseq | NP_002289.2 |
MIM | 153430 |
UniProt ID | P13796 |
◆ Recombinant Proteins | ||
LCP1-2303R | Recombinant Rhesus Macaque LCP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LCP1-4426H | Recombinant Human LCP1 Protein (Ser5-Lys233), His tagged | +Inquiry |
LCP1-1281H | Recombinant Human LCP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lcp1-3762M | Recombinant Mouse Lcp1 Protein, Myc/DDK-tagged | +Inquiry |
LCP1-1823C | Recombinant Chicken LCP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCP1-4795HCL | Recombinant Human LCP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LCP1 Products
Required fields are marked with *
My Review for All LCP1 Products
Required fields are marked with *
0
Inquiry Basket