Recombinant Human IL25 Protein
Cat.No. : | IL25-509H |
Product Overview : | Recombinant human IL25 protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 177 |
Description : | The protein encoded by this gene is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. Studies of a similar gene in mice suggest that this cytokine may be a pro-inflammatory cytokine favoring the Th2-type immune response. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized |
AA Sequence : | MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | IL25 interleukin 25 [ Homo sapiens (human) ] |
Official Symbol | IL25 |
Synonyms | IL25; interleukin 25; IL17E, interleukin 17E; interleukin-25; IL 17E; IL 25; interleukin 17E; interleukin-17E; IL17E; |
Gene ID | 64806 |
mRNA Refseq | NM_022789 |
Protein Refseq | NP_073626 |
MIM | 605658 |
UniProt ID | Q9H293 |
◆ Recombinant Proteins | ||
Il25-23M | Active Recombinant Mouse Il25 Protein (Val17-Ala169), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL25-2161M | Active Recombinant Mouse IL25 protein, His-tagged | +Inquiry |
IL25-149M | Recombinant Mouse IL25, His tagged | +Inquiry |
IL25-166M | Recombinant Mouse IL25 Protein | +Inquiry |
Il25-1813M | Recombinant Mouse Il25 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL25-2910MCL | Recombinant Mouse IL25 cell lysate | +Inquiry |
IL25-1261RCL | Recombinant Rat IL25 cell lysate | +Inquiry |
IL25-2920HCL | Recombinant Human IL25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL25 Products
Required fields are marked with *
My Review for All IL25 Products
Required fields are marked with *
0
Inquiry Basket