Recombinant Human TNF protein, His-tagged
Cat.No. : | TNF-244H |
Product Overview : | Recombinant Human TNF fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 100mM NaCl, pH 7.2 |
Molecular Mass : | 21.8kD |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL* |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | TNF tumor necrosis factor [ Homo sapiens ] |
Official Symbol | TNF |
Synonyms | TNF; tumor necrosis factor; TNFA, tumor necrosis factor (TNF superfamily, member 2); DIF; TNF superfamily; member 2; TNF alpha; TNFSF2; TNF-a; cachectin; APC1 protein; TNF, monocyte-derived; TNF, macrophage-derived; TNF superfamily, member 2; tumor necrosis factor alpha; tumor necrosis factor-alpha; tumor necrosis factor ligand superfamily member 2; TNFA; TNF-alpha; |
Gene ID | 7124 |
mRNA Refseq | NM_000594 |
Protein Refseq | NP_000585 |
MIM | 191160 |
UniProt ID | P01375 |
◆ Recombinant Proteins | ||
TNF-361H | Active Recombinant Human TNF protein, His-Avi-tagged, Biotinylated | +Inquiry |
TNF-171H | Active Recombinant Human TNF Protein, Biotinylated | +Inquiry |
TNF-64M | Recombinant Mouse TNF-alpha Soluble, FLAG-tagged | +Inquiry |
Tnf-237R | Recombinant Rat Tnf protein, His/S-tagged | +Inquiry |
TNF-0806H | Recombinant Human TNF protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNF Products
Required fields are marked with *
My Review for All TNF Products
Required fields are marked with *
0
Inquiry Basket