Recombinant Human TNF protein, His-tagged

Cat.No. : TNF-244H
Product Overview : Recombinant Human TNF fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 100mM NaCl, pH 7.2
Molecular Mass : 21.8kD
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL*
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name TNF tumor necrosis factor [ Homo sapiens ]
Official Symbol TNF
Synonyms TNF; tumor necrosis factor; TNFA, tumor necrosis factor (TNF superfamily, member 2); DIF; TNF superfamily; member 2; TNF alpha; TNFSF2; TNF-a; cachectin; APC1 protein; TNF, monocyte-derived; TNF, macrophage-derived; TNF superfamily, member 2; tumor necrosis factor alpha; tumor necrosis factor-alpha; tumor necrosis factor ligand superfamily member 2; TNFA; TNF-alpha;
Gene ID 7124
mRNA Refseq NM_000594
Protein Refseq NP_000585
MIM 191160
UniProt ID P01375

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNF Products

Required fields are marked with *

My Review for All TNF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon