| Species : |
Human |
| Source : |
Nicotiana Benthamiana |
| Tag : |
Non |
| Description : |
Recombinant human TFPI-2 domain 1 or AGV 212 is a protease inhibitor peptide generated from the first Kunitz domain of the human Tissue Factor Protein Inhibitor 2 (TFPI-2) protein, after site-directed mutagenesis to increase its activity. It is arranged in a single polypeptide chain that is linked by three disulphide bridges. AGV 212 is quite stable and inhibits trypsin with high efficiency and Ki lower than TFPI-2 one. TFPI-2 has been shown to inhibit Endothelial Cell Matrix (ECM) proteases essential for angiogenesis and metastasis. |
| Form : |
Lyophilized powder containing phosphate buffer salts, pH 7.1. |
| Bio-activity : |
The activity of the inhibitor is expressed as the amount of trypsin inhibited per milligram of inhibitor. The ability to prevent the hydrolysis of benzoyl-L-arginine ethyl ester hydrochloride by trypsin is measured by spectrophotometer. One mg protein will inhibit 1-1.5 mg trypsin with activity of approximately 10,000 BAEE units per mg protein. |
| Molecular Mass : |
Recombinant human TFPI-2 domain 1, is a 9.3 kDa protein containing 79 amino acids residues. |
| AA Sequence : |
HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEK VPKV |
| Endotoxin : |
< 0.04="" eu="" ug="" protein="" (lal=""> |
| Purity : |
>97% by SDS-PAGE gel |
| Applications : |
Trypsin inhibitor, Western blot, Immunogen |
| Storage : |
This lyophilized preparation is stable at 2-8°C, but should be kept at –20°C for long term storage. Diluted solutions are less stable than concentrated ones. Repeated freezing and thawing is not recommended. |
| Reconstitution : |
Lyophilized protein should be reconstituted adding 1 ml of sterile water to the vial, which gives a concentration of 1 mg of protease inhibitor per ml. At higher concentration the solubility may be reduced and multimers generated. Soluble in water and in aqueous buffers of low ionic strengths. Repeated freeze-thaw cycles should be avoided. Optimal reconstitution please follow batch Quality Control sheet instructions. |
