Recombinant Mouse Vegfa, Isoform 120, His-tagged Vegfa-726M

Recombinant Mouse Vegfa, Isoform 120, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Vegfa, Isoform 120, His-tagged

Recombinant Mouse Vegfa, Isoform 120, His-tagged

Vegfa Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Vegfa-726M
Product Overview : Mouse VEGF120 is expressed as a 131-amino acid protein consisting of the region Ala27 - Arg146 of mouse VEGF (UniProt Accession #Q00731-3, isoform VEGF120) and a C-terminal His-tag. It contains 1 potential sites for N-linked glycosylation and and exists as a dimer under non-reducing condition.
Source : Human cells
Species : Mouse
Tag : His
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Binds its receptors (FLT1, KDR) and anti-VEGF monoclonal antobodies with high affinity (KD< 10 nM as measured by ELISA). Stimulates HUVEC (human umbilical vein endothelial cells) proliferation and certain tumor cell growth.
Molecular Mass : Calculated molecular mass (kDa): 15.4; Estimated by SDS-PAGE under reducing condition (kDa): 20-25 (probably due to glycosylation)
AA Sequence : APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESN ITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRRSTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : Vegfa vascular endothelial growth factor A [ Mus musculus ]
Official Symbol : Vegfa
Synonyms : VEGFA; vascular endothelial growth factor A; vascular permeability factor; Vpf; Vegf; Vegf120; Vegf164; Vegf188;
Gene ID : 22339
mRNA Refseq : NM_001025250
Protein Refseq : NP_001020421
MIM :
UniProt ID :
Pathway : Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem;
Function : cell surface binding; chemoattractant activity; cytokine activity; fibronectin binding; growth factor activity; heparin binding; platelet-derived growth factor receptor binding; protein heterodimerization activity; protein homodimerization activity; receptor agonist activity; vascular endothelial growth factor receptor 1 binding; vascular endothelial growth factor receptor 2 binding; vascular endothelial growth factor receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy