"PLG" Related Products

Expand
Expand

Recombinant Human Plasminogen

Cat. No.: PLG-155H
Product Overview: Recombinant Human Angiostatin produced in E.coli is a single non-glycosylated polypeptide chain containing 259 amino acids and has a molecular mass of Approximately 30.0 KDa.
Description: Angiostatin K1-3 is a ~30 kDa fragment of plasminogen that has been shown to act as a potent inhibitor of angiogenesis and tumor growth in vitro and in vivo. Recombinant angiostatin is expressed in E. coli.
Sequences of amino acids: VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLE ENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISK TMSGLECQAWDSQSPHAHGYIPSKFNKNLKKNYCRNPDRELRPWCFTTD PNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHW SAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEY CKIPSCSSP
Purity: >95% by SDS-PAGE and HPLC analyses.
Biological Activity: Fully biologically active when compared to standard. The activity is assayed on anti-proliferation and anti-migration of endothelial cells in vitro and anti-angiogenesis in vivo. The specific activity of anti-migration of endothelial cells in vitro is 0.55×105Units/mg.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized from a 0.2μm filtered concentrated (1.0mg/ml) solution in 20mM NaAc, pH5.5, 4% mannitol.
Reconstitution: Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Endotoxin: Less than 1EU/μg of rHuAngiostatin as determined by LAL method.
Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Gene Name: PLG plasminogen [ Homo sapiens ]
Synonyms: PLG; plasminogen; DKFZp779M0222; plasmin;OTTHUMP00000017544; EC 3.4.21.7; Angiostatin
Gene ID: 5340
mRNA Refseq: NM_000301
Protein Refseq: NP_000292
MIM: 173350
UniProt ID: P00747
Chromosome Location: 6q26
Pathway: Complement and coagulation cascades; Neuroactive ligand-receptor interaction; Diabetes pathways; Hemostasis
Function: apolipoprotein binding; calcium ion binding; peptidase activity; serine-type endopeptidase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.