Recombinant Human IL23R protein, His-tagged
Cat.No. : | IL23R-3082H |
Product Overview : | Recombinant Human IL23R protein(31-130 aa), fused to His tag, was expressed in E. coli. |
Availability | October 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-130 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IL23R interleukin 23 receptor [ Homo sapiens ] |
Official Symbol | IL23R |
Synonyms | IL23R; interleukin 23 receptor; interleukin-23 receptor; IL 23R; IL-23 receptor; |
Gene ID | 149233 |
mRNA Refseq | NM_144701 |
Protein Refseq | NP_653302 |
MIM | 607562 |
UniProt ID | Q5VWK5 |
◆ Recombinant Proteins | ||
Il23r-71M | Recombinant Mouse Il23r Protein, His (Fc)-Avi-tagged | +Inquiry |
IL23R-1581C | Recombinant Canine IL23R protein, His-tagged | +Inquiry |
IL23R-589H | Recombinant Human IL23R protein, His-tagged | +Inquiry |
IL23R-0273H | Active Recombinant Human IL23R protein, Fc-tagged | +Inquiry |
IL23R-1110R | Recombinant Rat IL23R Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL23R-1234RCL | Recombinant Rat IL23R cell lysate | +Inquiry |
IL23R-1429CCL | Recombinant Cynomolgus IL23R cell lysate | +Inquiry |
IL23R-1213HCL | Recombinant Human IL23R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL23R Products
Required fields are marked with *
My Review for All IL23R Products
Required fields are marked with *