Recombinant Human IL23R protein, His-tagged
| Cat.No. : | IL23R-3082H |
| Product Overview : | Recombinant Human IL23R protein(31-130 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 31-130 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | IL23R interleukin 23 receptor [ Homo sapiens ] |
| Official Symbol | IL23R |
| Synonyms | IL23R; interleukin 23 receptor; interleukin-23 receptor; IL 23R; IL-23 receptor; |
| Gene ID | 149233 |
| mRNA Refseq | NM_144701 |
| Protein Refseq | NP_653302 |
| MIM | 607562 |
| UniProt ID | Q5VWK5 |
| ◆ Recombinant Proteins | ||
| IL23R-0272H | Active Recombinant Human IL23R protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
| IL23R-2400H | Recombinant Human IL23R protein(Met1-Asp353), hFc-tagged | +Inquiry |
| IL23R-348M | Active Recombinant Mouse IL23R protein, Fc-tagged | +Inquiry |
| IL23R-804R | Active Recombinant Rhesus Macaque IL23R protein, hFc-tagged | +Inquiry |
| Il23r-71M | Recombinant Mouse Il23r Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL23R-1213HCL | Recombinant Human IL23R cell lysate | +Inquiry |
| IL23R-1234RCL | Recombinant Rat IL23R cell lysate | +Inquiry |
| IL23R-1429CCL | Recombinant Cynomolgus IL23R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL23R Products
Required fields are marked with *
My Review for All IL23R Products
Required fields are marked with *
