Recombinant Human ITGA5 Protein, C-His-tagged

• Cat.No.: ITGA5-078H
• Product Overview: Recombinant Human ITGA5 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Integrins are α/β heterodimeric cell surface receptors that play a pivotal role in cell adhesion and migration, as well as in growth and survival. The integrin family contains at least 18 α and 8 β subunits that form 24 known integrins with distinct tissue distribution and overlapping ligand specificities. Integrins not only transmit signals to cells in response to the extracellular environment (outside-in signaling), but also sense intracellular cues to alter their interaction with the extracellular environment (inside-out signaling). Integrin α5/β1 is involved in multiple biological processes including embryonic development, angiogenesis and tumor metastasis. By interaction with its fibronectin ligand, α5/β1 transduces signals that regulate cell adhesion, migration, matrix assembly and cytoskeletal organization.
• Molecular Mass: ~13 kDa
• AA Sequence: PINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSY
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: ITGA5 integrin, alpha 5 (fibronectin receptor, alpha polypeptide) [ Homo sapiens (human) ]
• Official Symbol: ITGA5
• Synonyms: ITGA5; integrin, alpha 5 (fibronectin receptor, alpha polypeptide); FNRA; integrin alpha-5; CD49e; VLA-5; integrin alpha-F; CD49 antigen-like family member E; fibronectin receptor subunit alpha; fibronectin receptor, alpha subunit; very late activation protein 5, alpha subunit; VLA5A
• Gene ID: 3678
• mRNA Refseq: NM_002205
• Protein Refseq: NP_002196
• MIM: 135620
• UniProt ID: P08648