Recombinant Human ITGA5 Protein, C-His-tagged
Cat.No. : | ITGA5-078H |
Product Overview : | Recombinant Human ITGA5 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Integrins are α/β heterodimeric cell surface receptors that play a pivotal role in cell adhesion and migration, as well as in growth and survival. The integrin family contains at least 18 α and 8 β subunits that form 24 known integrins with distinct tissue distribution and overlapping ligand specificities. Integrins not only transmit signals to cells in response to the extracellular environment (outside-in signaling), but also sense intracellular cues to alter their interaction with the extracellular environment (inside-out signaling). Integrin α5/β1 is involved in multiple biological processes including embryonic development, angiogenesis and tumor metastasis. By interaction with its fibronectin ligand, α5/β1 transduces signals that regulate cell adhesion, migration, matrix assembly and cytoskeletal organization. |
Molecular Mass : | ~13 kDa |
AA Sequence : | PINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSY |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | ITGA5 integrin, alpha 5 (fibronectin receptor, alpha polypeptide) [ Homo sapiens (human) ] |
Official Symbol | ITGA5 |
Synonyms | ITGA5; integrin, alpha 5 (fibronectin receptor, alpha polypeptide); FNRA; integrin alpha-5; CD49e; VLA-5; integrin alpha-F; CD49 antigen-like family member E; fibronectin receptor subunit alpha; fibronectin receptor, alpha subunit; very late activation protein 5, alpha subunit; VLA5A; |
Gene ID | 3678 |
mRNA Refseq | NM_002205 |
Protein Refseq | NP_002196 |
MIM | 135620 |
UniProt ID | P08648 |
◆ Recombinant Proteins | ||
ITGA5-2935H | Recombinant Human ITGA5 protein, His-tagged | +Inquiry |
ITGA5 & ITGB1-1878H | Active Recombinant Human ITGA5 & ITGB1 protein, Flag & His-tagged | +Inquiry |
Itga5-1697R | Recombinant Rat Itga5 Protein, His-tagged | +Inquiry |
ITGA5-4638M | Recombinant Mouse ITGA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGA5-6771H | Recombinant Human ITGA5 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGA5-5132HCL | Recombinant Human ITGA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA5 Products
Required fields are marked with *
My Review for All ITGA5 Products
Required fields are marked with *