We use cookies to understand how you use our site and to improve the overall user experience. This includes
personalizing content and advertising. Read our Privacy Policy
IL33 (MIM 608678) is a member of the IL1 (see MIM 147760) family that potently drives production of T helper-2 (Th2)-associated cytokines (e.g., IL4; MIM 147780). IL33 is a ligand for IL33R (IL1RL1; MIM 601203), an IL1 family receptor that is selectively expressed on Th2 cells and mast cells (summary by Yagami et al., 2010 [PubMed 20926795]).[supplied by OMIM, Jan 2011]
Synonyms
IL33;interleukin 33;DVS27;IL1F11;NF-HEV;NFEHEV;C9orf26;interleukin-33;IL-33;IL-1F11;DVS27-related protein;interleukin-1 family member 11;nuclear factor for high endothelial venules;nuclear factor from high endothelial venules
Il33 involved in several pathways and played different roles in them. We selected most pathways Il33 participated on our site, such as Cytosolic DNA-sensing pathway,Influenza A, which may be useful for your reference. Also, other proteins which involved in the same pathway with Il33 were listed below. Creative BioMart supplied nearly all the proteins listed, you can search them on our site.
Il33 has several biochemical functions, for example, cytokine activity,protein binding. Some of the functions are cooperated with other proteins, some of the functions could acted by Il33 itself. We selected most functions Il33 had, and list some proteins which have the same functions with Il33. You can find most of the proteins on our site.
Il33 has direct interactions with proteins and molecules. Those interactions were detected by several methods such as yeast two hybrid, co-IP, pull-down and so on. We selected proteins and molecules interacted with Il33 here. Most of them are supplied by our site. Hope this information will be useful for your research of Il33.
Li, C; Mu, R; et al. Genetic variant in IL33 is associated with susceptibility to rheumatoid arthritis. ARTHRITIS RESEARCH & THERAPY 16:-(2014).
Tordesillas, L; Gomez-Casado, C; et al. Transport of Pru p 3 across gastrointestinal epithelium - an essential step towards the induction of food allergy?. CLINICAL AND EXPERIMENTAL ALLERGY 43:1374-1383(2013).
Can you please provide me the AA sequence of this protein?
05/27/2024
IL33-124H: The extracellular domain of human IL-33 (aa 112-270) is fused to the N-terminus of the Human IgG Fc region (aa 100-330) containing the hinge sequence.
Human IL-33: https://www.ncbi.nlm.nih.gov/protein/AAH47085.1
SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Human IgG: https://www.uniprot.org/uniprotkb/P01857/entry
PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPEL
