| Species : |
Rat |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
26-635aa |
| Description : |
Enables lipopolysaccharide binding activity and phosphatidylinositol 3-kinase binding activity. Involved in several processes, including detection of stimulus involved in sensory perception of pain; immune response-regulating signaling pathway; and response to steroid hormone. Located in cell surface and cytoplasm. Colocalizes with membrane raft. Used to study several diseases, including carotid stenosis; ileitis; neuropathy (multiple); obesity; and renal fibrosis. Biomarker of several diseases, including kidney failure (multiple); pancreatitis (multiple); perinatal necrotizing enterocolitis; pulpitis; and sciatic neuropathy. Human ortholog(s) of this gene implicated in several diseases, including allergic contact dermatitis (multiple); artery disease (multiple); autoimmune disease (multiple); eye disease (multiple); and lung disease (multiple). Orthologous to human TLR4 (toll like receptor 4). |
| Molecular Mass : |
The protein has a calculated MW of 71 kDa. |
| AA Sequence : |
NPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDLSFNPLKILRSYSFTNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGSFSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVDLSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSNVLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYINHFSDDIYNLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLTTNREDISFGQLALPSLRYLDLSRNAMSFRGCCSYSDFGTNNLKYLDLSFNGVILMSANFMGLEELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNSFKDNTLSNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQLYSLRTLDCSFNRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVNVEQMKCASPIDMKASLVLDFTNSTCYIYKTIISVSHHHHHHHH |
| Endotoxin : |
<1 EU/μg by LAL |
| Purity : |
>80% by SDS-PAGE |
| Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : |
0.034 mg/mL by BCA |
| Storage Buffer : |
Sterile PBS, pH 7.4. |
