Recombinant Rat Tlr4 Protein, 26-635aa, C-8×His tagged
Cat.No. : | TLR4-6084R |
Product Overview : | Recombinant Rat TLR4 Protein (26-635aa) with C-8×His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Tag : | His |
Protein Length : | 26-635aa |
Description : | Enables lipopolysaccharide binding activity and phosphatidylinositol 3-kinase binding activity. Involved in several processes, including detection of stimulus involved in sensory perception of pain; immune response-regulating signaling pathway; and response to steroid hormone. Located in cell surface and cytoplasm. Colocalizes with membrane raft. Used to study several diseases, including carotid stenosis; ileitis; neuropathy (multiple); obesity; and renal fibrosis. Biomarker of several diseases, including kidney failure (multiple); pancreatitis (multiple); perinatal necrotizing enterocolitis; pulpitis; and sciatic neuropathy. Human ortholog(s) of this gene implicated in several diseases, including allergic contact dermatitis (multiple); artery disease (multiple); autoimmune disease (multiple); eye disease (multiple); and lung disease (multiple). Orthologous to human TLR4 (toll like receptor 4). |
Molecular Mass : | The protein has a calculated MW of 71 kDa. |
AA Sequence : | NPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDLSFNPLKILRSYSFTNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGSFSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVDLSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSNVLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYINHFSDDIYNLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLTTNREDISFGQLALPSLRYLDLSRNAMSFRGCCSYSDFGTNNLKYLDLSFNGVILMSANFMGLEELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNSFKDNTLSNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQLYSLRTLDCSFNRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVNVEQMKCASPIDMKASLVLDFTNSTCYIYKTIISVSHHHHHHHH |
Endotoxin : | <1 EU/μg by LAL |
Purity : | >80% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.034 mg/mL by BCA |
Storage Buffer : | Sterile PBS, pH 7.4. |
Gene Name | Tlr4 toll-like receptor 4 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Tlr4 |
Synonyms | Tlr4; toll-like receptor 4; toll-like receptor 4; toll4; EC 3.2.2.6 |
Gene ID | 29260 |
mRNA Refseq | NM_019178 |
Protein Refseq | NP_062051 |
UniProt ID | G3V7D8 |
◆ Recombinant Proteins | ||
TLR4-1674R | Recombinant Rhesus Monkey TLR4 Protein, hIgG1-tagged | +Inquiry |
TLR4-2396C | Recombinant Chicken TLR4 | +Inquiry |
TLR4-293H | Recombinant Human TLR4 | +Inquiry |
TLR4-16826M | Recombinant Mouse TLR4 Protein | +Inquiry |
TLR4-292H | Recombinant Human TLR4, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR4-402HCL | Recombinant Human TLR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tlr4 Products
Required fields are marked with *
My Review for All Tlr4 Products
Required fields are marked with *