Recombinant Human IL10RA
Cat.No. : | IL10RA-29631TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-232 of Human IL10RAfused to the Fc region of human IgG1 , with N-linked and O-linked oligosaccharides, and expressed in modified human 293 cells. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases. Two transcript variants, one protein-coding and the other not protein-coding, have been found for this gene. |
Tissue specificity : | Spleen, thymus, and PBMC. Weak expression in pancreas, skeletal muscle, brain, heart, and kidney. Placenta, lung, and liver showed intermediate levels. Monocytes, B-cells, large granular lymphocytes, and T-cells express high levels. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:HGTELPSPPSVWFEAEFFHHILHWTPIPN QSESTCYEVALLRYGIESWNSISNCSQTLSYDLTAVTL DLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVG SVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFRE YEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVK PSVASRSNKGMWSKEECISLTRQYFTGIPKVDKKVEPK SCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCRVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Sequence Similarities : | Belongs to the type II cytokine receptor family. |
Gene Name : | IL10RA interleukin 10 receptor, alpha [ Homo sapiens ] |
Official Symbol : | IL10RA |
Synonyms : | IL10RA; interleukin 10 receptor, alpha; IL10R; interleukin-10 receptor subunit alpha; CD210a; CDW210A; HIL 10R; |
Gene ID : | 3587 |
mRNA Refseq : | NM_001558 |
Protein Refseq : | NP_001549 |
MIM : | 146933 |
Uniprot ID : | Q13651 |
Chromosome Location : | 11q23 |
Pathway : | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; Toxoplasmosis, organism-specific biosystem; |
Function : | interleukin-10 receptor activity; protein binding; receptor activity; signal transducer activity; |
Products Types
◆ Recombinant Protein | ||
IL10RA-002H | Active Recombinant Human IL10RA Protein | +Inquiry |
IL10RA-073H | Recombinant Human IL10RA Protein, His-tagged | +Inquiry |
Il10ra-1658M | Recombinant Mouse Il10ra Protein, His-tagged | +Inquiry |
IL10RA-988R | Active Recombinant Rhesus IL10RA Protein (Thr9-Asn245), His-tagged | +Inquiry |
IL10RA-2860H | Recombinant Human IL10RA protein(31-230 aa), N-SUMO & C-His-tagged | +Inquiry |
◆ Lysates | ||
IL10RA-1185CCL | Recombinant Cynomolgus IL10RA cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket