"IL10RA" Related Products

Expand
Expand

Recombinant Human IL10RA

Cat.No.: IL10RA-29631TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-232 of Human IL10RAfused to the Fc region of human IgG1 , with N-linked and O-linked oligosaccharides, and expressed in modified human 293 cells.
Description: The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases. Two transcript variants, one protein-coding and the other not protein-coding, have been found for this gene.
Tissue specificity: Spleen, thymus, and PBMC. Weak expression in pancreas, skeletal muscle, brain, heart, and kidney. Placenta, lung, and liver showed intermediate levels. Monocytes, B-cells, large granular lymphocytes, and T-cells express high levels.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS
Storage: Store at +4°C.
Sequences of amino acids: Theoretical Sequence:HGTELPSPPSVWFEAEFFHHILHWTPIPN QSESTCYEVALLRYGIESWNSISNCSQTLSYDLTAVTL DLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVG SVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFRE YEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVK PSVASRSNKGMWSKEECISLTRQYFTGIPKVDKKVEPK SCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCRVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Sequence Similarities: Belongs to the type II cytokine receptor family.
Gene Name: IL10RA interleukin 10 receptor, alpha [ Homo sapiens ]
Official Symbol: IL10RA
Synonyms: IL10RA; interleukin 10 receptor, alpha; IL10R; interleukin-10 receptor subunit alpha; CD210a; CDW210A; HIL 10R;
Gene ID: 3587
mRNA Refseq: NM_001558
Protein Refseq: NP_001549
MIM: 146933
Uniprot ID: Q13651
Chromosome Location: 11q23
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; Toxoplasmosis, organism-specific biosystem;
Function: interleukin-10 receptor activity; protein binding; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.