"IL8" Related Products

Expand
Expand

Recombinant Human IL8, StrepII-tagged

Cat.No.: IL8-273H
Product Overview: Purified, full-length human recombinant IL8 protein (amino acids 21-99, 79 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 11.1 kDa. (Accession NP_000575; UniProt P10145)
Description: IL8 is a member of the CXC chemokine family. It is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. In addition to acting as a chemoattractant, it is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
Protein length: 21-99, 79 a.a.
AA Sequence: EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKR AENS
Endotoxin: <0.1 eu per ug protein by lal
Purity: >90% by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml
Gene Name: IL8 interleukin 8 [ Homo sapiens ]
Official Symbol: IL8
Synonyms: IL8; interleukin 8; interleukin-8; 3 10C; alveolar macrophage chemotactic factor I; AMCF I; b ENAP; beta endothelial cell derived neutrophil activating peptide; chemokine (C X C motif) ligand 8; CXCL8; GCP 1; GCP1; granulocyte chemotactic protein 1; IL 8; K60; LECT; LUCT; lung giant cell carcinoma derived chemotactic protein; lymphocyte derived neutrophil activating peptide; LYNAP; MDNCF; MONAP; monocyte derived neutrophil chemotactic factor; monocyte derived neutrophil activating peptide; NAF; NAP 1; NAP1; neutrophil activating peptide 1; SCYB8; TSG 1; tumor necrosis factor induced gene 1; emoctakin; T-cell chemotactic factor; neutrophil-activating peptide 1; chemokine (C-X-C motif) ligand 8; beta-thromboglobulin-like protein; tumor necrosis factor-induced gene 1; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; small inducible cytokine subfamily B, member 8; lung giant cell carcinoma-derived chemotactic protein; beta endothelial cell-derived neutrophil activating peptide; GCP-1; NAP-1;
Gene ID: 3576
mRNA Refseq: NM_000584
Protein Refseq: NP_000575
MIM: 146930
UniProt ID: P10145
Chromosome Location: 4q13-q21
Pathway: ATF-2 transcription factor network, organism-specific biosystem; Activation of Genes by ATF4, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem;
Function: chemokine activity; interleukin-8 receptor binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.